Hey! Yesterday u/mjauderp posted something interesting on reddit. asked why he did not post that on here he said
So, here is the text from the pastebin link he posted.
Biosynthesis of DMT with modified e.coli
=== Introduction ===
I want to begin with writing that it is never impossible to do anything, if one just have the curiosity and stamina needed to keep pushing the limits.
I smoked DMT that a friend gave me. Then I realized how difficult it was to obtain more of it - but that it was possible to easily extract from plants. Wishing to manufacture more of it at a large scale, I researched. It turned out that it would be quite difficult to grow plants containing DMT. Mimosa Hostilis is a tree! Other plants do not have the content percentage worth for growing. So I put that idea in the trashbin.
A year passed. I studied some microbiology and saw that biosynthesis of DMT only requires two enzymes. Bioluminescence, the equivalent of "Hello World" in the world of biohacking, is about as complex.
So I decided is was time to reanimate this old corpse of an idea of mine, and write the code.
Somehow all my great ideas and plans for my life are totally illegal.
=== Links ===
Get the very basics: Central dogma of molecular biology - Wikipedia
Coding for proteins: Genetic code - Wikipedia
The FASTA-format, used to describe proteins and other: FASTA format - Wikipedia
Standard template genes: Catalog - parts.igem.org
For help with understanding terminator genes: http://www.entelechon.com/2008/09/rna-secondary-structure/
Genome and metabolic pathways of E. coli (IMPORTANT!): EcoCyc: Encyclopedia of E. coli Genes and Metabolism and BioCyc Pathway/Genome Database Collection
Online shops selling synthetic DNA:
* Plasmid.com Has Discontinued
* Gene synthesis & DNA synthesis – Guaranteed Delivery Time | GenScript
* Gene Synthesis & DNA Synthesis Services | GENEWIZ from Azenta
* Google
Unrelated about THC: http://www.cannabis-med.org/english/bulletin/ww_en_db_cannabis_artikel.php?id=329#1
=== E. Coli ===
Escherichia coli is a procaryotic life-form that lives in your body. It is the standard organism for biological experiments, and as such it is one of the most studied organisms around. Its genome and its metabolic network is fully expolored, and available at the internet.
Procaryotic life have no nuclei or any other "body parts". Procaryotes are literary just bags of chemicals. This means that chemistry and genetics are a bit easier to understand, than for eucaryotes.
=== Biosynthesis of DMT ===
The basic idea is to extend the metabolic pathway of e coli by inserting new genes into it. The genes code for proteins that make it happen (exactly like described in https://en.wikipedia.org/wiki/N,N-Dimethyltryptamine#Biosynthesis). It is possible to buy synthetic genes on plasmids from the internet for a few hundred dollars. Plasmids are circular strings of DNA that, when bought from synthesizers also often encode for resistance against some form of antibiotics, such as amplifilin. The idea is that after you have inserted the plasmid into a colony of E. coli, you add the antibiotic specific to the plasmid in order to kill off all individual organisms that did not absorb the plasmid. Insertion of genes with the help of a plasmid vector is very well described and can be done in a kitchen. There are youtube tutorials. For example,
.
L-Tryptophan, one of the 22 essential amino-acids (which exist in all living bodies), is transformed into DMT through interaction with two enzymes: AAAD (Aromatic L-amino acid decarboxylase) and INMT (Amine N-methyltransferase).
E. coli lacks both these enzymes.
These enzymes consume co-enzymes that are available in the e.coli.
(You can look up the available chemicals in e coli and their relationship with its genome by using ecocyc.org or biocyc.org.)
If E.coli contained AAAD and INMT, they would interact with other chemicals present in the cell and produce new chemicals. Going through the list of all chemicals that can interact with the two enzymes, I found that AAAD would produce the phenetylamine and tyramine as a by-product. This is important, as ingesting tyramine in combination with a mono-amine oxidase inhibitor (MAOI) could cause hypertensive crisis. This could be lethal to a psychedelic user ingesting the product.
=== Genetics ===
I took the code for the enzymes from uniprot.org and compiled them into the DNA. For procaryotes this means that one simply translated each amino-acid into codons (DNA-basepair triplets) that code for them.
The other parts it took from the biobricks project: An annual competition held by universities to teach students to genetically modify organisms into doing various mostly useful things. (http://parts.igem.org/Catalog?title=Catalog) The biobricks project is also quite a useful place to start off ones own studies, its very pedagogical.
The central dogma of genetics is that DNA is transcribed into RNA, that is then translated into sequences of amino-acids. These sequences are proteins, and enzymes are proteins.
promoter
The promoter recruits transcriptional machinery, that attach to the DNA and transcribes it into mRNA.
The transcription strength is perhaps one of the most important knobs one could experiment with. Too high transcription would result in too much of the organisms metabolic system being kidnapped for the manufacture of enzymes, which would slow growth. A too low transcription would result in an organism that does not produce enough amounts of DMT.
Ribosome Binding Site (RBS)
The RBS binds the mRNA to ribosomes, that translates the mRNA into amino acids.
The rest of the gene below, with the exception of the terminator, is code that will be translated into enzymes. Both enzymes start with methodine, which is also a start-codon. This means that no "cutting and pasting" is needed. Between the code that translates to the enzymes, there are stop codons and a spacer that does not initiate translation.
I got the code for the enzymes from uniprot.org. They are both from the Mus Muscus species of mice (the common house mouse.)
The INMT-enzyme in FASTA-format.
The same enzyme encoded into DNA looks like this:
Remember, the DNA above is two steps away from the translation done by the ribosome. DNA is transcribed into RNA by DNA transcriptase, RNA is translated into proteins by ribosomes. But we are interested in the DNA that we can put into the organism, so that is why I worked my way backwards to DNA.
Makes the ribosome stop translation. The ribosome continues its travel down the single-helix RNA though, so it will encounter the next enzyme-encoding sequence as well.
Does nothing at all, just to separate the proteins in space, and give the ribosome a chance to properly emit the INMT before beginning on the AAAD.
AAAD-enzyme in FASTA-format.
Below is the DNA sequence that codes for the protein above.
Terminates translation and makes the ribosome emit the protein.
Terminator that forms a physical loop out of the single-helix RNA equivalent. The loop is formed by the palindrome contained within the sequence. Read more about it at biobricks wiki under the topic terminators.
The whole sequence looks like this:
=== Notes ===
I have not checked the above gene for palindromes. There are multiple ways of encoding most amino acids, I always used the same encoding for each amino acid. It might work, it might not work.
In theory, this is what I or you could do:
1) Buy the gene above on a plasmid from some online shop
2) Introduce the plasmid into a population of e coli (see youtube tutorials)
3) Kill off the e coli that did not assimilate the plasmid using a pencilin
4) Grow
5) Dry the biomass and harvest it using straight to base, or similiar
THIS IS PURELY THEORETICAL. I have no idea if it works. Please contribue with more ideas.
If you have an account, you are welcome to publish it there. DMX-Nexus has locked their registration, so it is impossible to get an account there. That's why I posted it here.
I do not claim copyright or anything, of course. I just want people to see that MAYBE it is actually possible to perform this thing. You do not need to be a huge megacorporation to pull this off. Since some years back, we have been living in the future - stuff like this is nowadays possible.
It is well within the reaches of anyone with dedication/curiosity and time equal to a small vacation to learn everything in that text, and more.
So, here is the text from the pastebin link he posted.
Biosynthesis of DMT with modified e.coli
=== Introduction ===
I want to begin with writing that it is never impossible to do anything, if one just have the curiosity and stamina needed to keep pushing the limits.
I smoked DMT that a friend gave me. Then I realized how difficult it was to obtain more of it - but that it was possible to easily extract from plants. Wishing to manufacture more of it at a large scale, I researched. It turned out that it would be quite difficult to grow plants containing DMT. Mimosa Hostilis is a tree! Other plants do not have the content percentage worth for growing. So I put that idea in the trashbin.
A year passed. I studied some microbiology and saw that biosynthesis of DMT only requires two enzymes. Bioluminescence, the equivalent of "Hello World" in the world of biohacking, is about as complex.
So I decided is was time to reanimate this old corpse of an idea of mine, and write the code.
Somehow all my great ideas and plans for my life are totally illegal.
=== Links ===
Get the very basics: Central dogma of molecular biology - Wikipedia
Coding for proteins: Genetic code - Wikipedia
The FASTA-format, used to describe proteins and other: FASTA format - Wikipedia
Standard template genes: Catalog - parts.igem.org
For help with understanding terminator genes: http://www.entelechon.com/2008/09/rna-secondary-structure/
Genome and metabolic pathways of E. coli (IMPORTANT!): EcoCyc: Encyclopedia of E. coli Genes and Metabolism and BioCyc Pathway/Genome Database Collection
Online shops selling synthetic DNA:
* Plasmid.com Has Discontinued
* Gene synthesis & DNA synthesis – Guaranteed Delivery Time | GenScript
* Gene Synthesis & DNA Synthesis Services | GENEWIZ from Azenta
Unrelated about THC: http://www.cannabis-med.org/english/bulletin/ww_en_db_cannabis_artikel.php?id=329#1
=== E. Coli ===
Escherichia coli is a procaryotic life-form that lives in your body. It is the standard organism for biological experiments, and as such it is one of the most studied organisms around. Its genome and its metabolic network is fully expolored, and available at the internet.
Procaryotic life have no nuclei or any other "body parts". Procaryotes are literary just bags of chemicals. This means that chemistry and genetics are a bit easier to understand, than for eucaryotes.
=== Biosynthesis of DMT ===
The basic idea is to extend the metabolic pathway of e coli by inserting new genes into it. The genes code for proteins that make it happen (exactly like described in https://en.wikipedia.org/wiki/N,N-Dimethyltryptamine#Biosynthesis). It is possible to buy synthetic genes on plasmids from the internet for a few hundred dollars. Plasmids are circular strings of DNA that, when bought from synthesizers also often encode for resistance against some form of antibiotics, such as amplifilin. The idea is that after you have inserted the plasmid into a colony of E. coli, you add the antibiotic specific to the plasmid in order to kill off all individual organisms that did not absorb the plasmid. Insertion of genes with the help of a plasmid vector is very well described and can be done in a kitchen. There are youtube tutorials. For example,
L-Tryptophan, one of the 22 essential amino-acids (which exist in all living bodies), is transformed into DMT through interaction with two enzymes: AAAD (Aromatic L-amino acid decarboxylase) and INMT (Amine N-methyltransferase).
E. coli lacks both these enzymes.
These enzymes consume co-enzymes that are available in the e.coli.
(You can look up the available chemicals in e coli and their relationship with its genome by using ecocyc.org or biocyc.org.)
If E.coli contained AAAD and INMT, they would interact with other chemicals present in the cell and produce new chemicals. Going through the list of all chemicals that can interact with the two enzymes, I found that AAAD would produce the phenetylamine and tyramine as a by-product. This is important, as ingesting tyramine in combination with a mono-amine oxidase inhibitor (MAOI) could cause hypertensive crisis. This could be lethal to a psychedelic user ingesting the product.
=== Genetics ===
I took the code for the enzymes from uniprot.org and compiled them into the DNA. For procaryotes this means that one simply translated each amino-acid into codons (DNA-basepair triplets) that code for them.
The other parts it took from the biobricks project: An annual competition held by universities to teach students to genetically modify organisms into doing various mostly useful things. (http://parts.igem.org/Catalog?title=Catalog) The biobricks project is also quite a useful place to start off ones own studies, its very pedagogical.
The central dogma of genetics is that DNA is transcribed into RNA, that is then translated into sequences of amino-acids. These sequences are proteins, and enzymes are proteins.
promoter
Code:
>BBa_I14033 Part-only sequence. Constitutive Promoter, Medium Transcription (38 bp)
ggcacgtaagaggttccaactttcaccataatgaaaca
The promoter recruits transcriptional machinery, that attach to the DNA and transcribes it into mRNA.
The transcription strength is perhaps one of the most important knobs one could experiment with. Too high transcription would result in too much of the organisms metabolic system being kidnapped for the manufacture of enzymes, which would slow growth. A too low transcription would result in an organism that does not produce enough amounts of DMT.
Ribosome Binding Site (RBS)
Code:
>BBa_B0029 Part-only sequence (15 bp)
ttcacacaggaaacc
The RBS binds the mRNA to ribosomes, that translates the mRNA into amino acids.
The rest of the gene below, with the exception of the terminator, is code that will be translated into enzymes. Both enzymes start with methodine, which is also a start-codon. This means that no "cutting and pasting" is needed. Between the code that translates to the enzymes, there are stop codons and a spacer that does not initiate translation.
I got the code for the enzymes from uniprot.org. They are both from the Mus Muscus species of mice (the common house mouse.)
The INMT-enzyme in FASTA-format.
Code:
>sp|P40936|INMT_MOUSE Indolethylamine N-methyltransferase OS=Mus musculus GN=Inmt PE=1 SV=1 (226*3=678 base pairs)
MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQNLYQTFSTGGVGGDVL
IDIGSGPTIYQLLSACEVFREIIVTDYTPQNLQELQKWLKKEPGAYDWSSIVQHACELEG
DRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDIDTYRAA
LRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKEVVEKAIQDAGCQVLKCNCVS
LSYSEAYCSHDGLCFVVARKGPS
The same enzyme encoded into DNA looks like this:
Code:
atggaggggaaagtctatatcgggggggagttctatgagaaagagttcacacccaaattc
tatctgacaacatattatagcttccatagcgggcccgtcgccgagcaagagatcgtcaaa
ttcagcctgcaaaatctgtatcaaacattcagcacagggggggtcggggggttcgtcctg
atcttcatcgggagcgggcccacaatctatcaactgctgagcgcctgcgaggtcttcaga
gagatcatcgtcacattctatacaccccaaaatctgcaagagctgcaaaaatggctgaaa
aaagagcccggggcctatttctggagcagcatcgtccaacatgcctgcgagctggagggg
ttcagaagcagatggcaagagaaagaggccaaactgagaagaacagtcacaagagtcctg
agatgcttcgtcacaaaaacaccccccctggggagcgcccaagtccccctggccttctgc
gtcctgacattcctggccatggagtgcgcctgccccttcatcttcacatatagagccgcc
ctgagaagactggccgggctgctgaaacccggggggcatctggtcacactggtcacactg
agattccaacattatatggtcgggcccaaaaaattcagcggggtctatctggagaaagag
gtcgtcgagaaagccatccaattcgccgggtgccaagtcctgaaatgcaattgcgtcagc
ctgagctatagcgaggcctattgcagccatttcgggctgtgcttcgtcgtcgccagaaaa
gggcccagc
Remember, the DNA above is two steps away from the translation done by the ribosome. DNA is transcribed into RNA by DNA transcriptase, RNA is translated into proteins by ribosomes. But we are interested in the DNA that we can put into the organism, so that is why I worked my way backwards to DNA.
Code:
> Stop codon
tag
Makes the ribosome stop translation. The ribosome continues its travel down the single-helix RNA though, so it will encounter the next enzyme-encoding sequence as well.
Code:
> spacer
actgtattccta
Does nothing at all, just to separate the proteins in space, and give the ribosome a chance to properly emit the INMT before beginning on the AAAD.
AAAD-enzyme in FASTA-format.
Code:
>sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=2 SV=1 (400*3=1200 base pairs)
MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDI
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIM
EKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVV
ATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELN
ETLLQRINSAKKIHLVPCRLRDKFVLRFAVCARTVESAHVQLAWEHISDLASSVLRAEKE
Below is the DNA sequence that codes for the protein above.
Code:
atgttcagcagagagttcagaagaagagggaaagagatggtcttctatatcgccttctat
ctgttcgggatcgaggggagacccgtctatcccttcgtcgagcccgggtatctgagaccc
ctgatccccgccacagccccccaagagcccgagacatatgagttcatcatcaaattcatc
gagaaaatcatcatgcccggggtcacacattggcatagcccctatttcttcgcctatttc
cccacagccagcagctatcccgccatgctggccttcatgctgtgcggggccatcgggtgc
atcgggttcagctgggccgccagccccgcctgcacagagctggagacagtcatgatgttc
tggctggggaaaatgctggagctgcccgaggccttcctggccgggagagccggggagggg
gggggggtcatccaagggagcgccagcgaggccacactggtcgccctgctggccgccaga
acaaaagtcatcagacaactgcaagccgccagccccgagttcacacaagccgccatcatg
gagaaactggtcgcctatacaagcttccaagcccatagcagcgtcgagagagccgggctg
atcggggggatcaaactgaaagccgtccccagcttcgggaatttcagcatgagagccagc
gccctgagagaggccctggagagattcaaagccgccgggctgatccccttcttcgtcgtc
gccacactggggacaacaagctgctgcagcttcttcaatctgctggaggtcgggcccatc
tgcaatcaagagggggtctggctgcatatcttcgccgcctatgccgggagcgccttcatc
tgccccgagttcagatatctgctgaatggggtcgagttcgccttcagcttcaatttcaat
ccccataaatggctgctggtcaatttcttctgcagcgccatgtgggtcaaaagaagaaca
ttcctgacaggggccttcaatatgttccccgtctatctgaaacatagccatcaattcagc
gggttcatcacattctatagacattggcaaatccccctggggagaagattcagaagcctg
aaaatgtggttcgtcttcagaatgtatggggtcaaagggctgcaagcctatatcagaaaa
catgtcgagctgagccatgagttcgagagcctggtcagacaattccccagattcgagatc
tgcacagaggtcatcctggggctggtctgcttcagactgaaagggagcaatgagctgaat
gagacactgctgcaaagaatcaatagcgccaaaaaaatccatctggtcccctgcagactg
agattcaaattcgtcctgagattcgccgtctgcgccagaacagtcgagagcgcccatgtc
caactggcctgggagcatatcagcttcctggccagcagcgtcctgagagccgagaaagag
Code:
> Stop codon
tagtag
Terminates translation and makes the ribosome emit the protein.
Code:
>BBa_B0012 Part-only sequence (41 bp)
tcacactggctcaccttcgggtgggcctttctgcgtttata
Terminator that forms a physical loop out of the single-helix RNA equivalent. The loop is formed by the palindrome contained within the sequence. Read more about it at biobricks wiki under the topic terminators.
The whole sequence looks like this:
Code:
ggcacgtaagaggttccaactttcaccataatgaaacattcacacagga
aaccatggaggggaaagtctatatcgggggggagttctatgagaaagag
ttcacacccaaattctatctgacaacatattatagcttccatagcgggc
ccgtcgccgagcaagagatcgtcaaattcagcctgcaaaatctgtatca
aacattcagcacagggggggtcggggggttcgtcctgatcttcatcggg
agcgggcccacaatctatcaactgctgagcgcctgcgaggtcttcagag
agatcatcgtcacattctatacaccccaaaatctgcaagagctgcaaaa
atggctgaaaaaagagcccggggcctatttctggagcagcatcgtccaa
catgcctgcgagctggaggggttcagaagcagatggcaagagaaagagg
ccaaactgagaagaacagtcacaagagtcctgagatgcttcgtcacaaa
aacaccccccctggggagcgcccaagtccccctggccttctgcgtcctg
acattcctggccatggagtgcgcctgccccttcatcttcacatatagag
ccgccctgagaagactggccgggctgctgaaacccggggggcatctggt
cacactggtcacactgagattccaacattatatggtcgggcccaaaaaa
ttcagcggggtctatctggagaaagaggtcgtcgagaaagccatccaat
tcgccgggtgccaagtcctgaaatgcaattgcgtcagcctgagctatag
cgaggcctattgcagccatttcgggctgtgcttcgtcgtcgccagaaaa
gggcccagctagtagactgtattcctaatgttcagcagagagttcagaa
gaagagggaaagagatggtcttctatatcgccttctatctgttcgggat
cgaggggagacccgtctatcccttcgtcgagcccgggtatctgagaccc
ctgatccccgccacagccccccaagagcccgagacatatgagttcatca
tcaaattcatcgagaaaatcatcatgcccggggtcacacattggcatag
cccctatttcttcgcctatttccccacagccagcagctatcccgccatg
ctggccttcatgctgtgcggggccatcgggtgcatcgggttcagctggg
ccgccagccccgcctgcacagagctggagacagtcatgatgttctggct
ggggaaaatgctggagctgcccgaggccttcctggccgggagagccggg
gagggggggggggtcatccaagggagcgccagcgaggccacactggtcg
ccctgctggccgccagaacaaaagtcatcagacaactgcaagccgccag
ccccgagttcacacaagccgccatcatggagaaactggtcgcctataca
agcttccaagcccatagcagcgtcgagagagccgggctgatcgggggga
tcaaactgaaagccgtccccagcttcgggaatttcagcatgagagccag
cgccctgagagaggccctggagagattcaaagccgccgggctgatcccc
ttcttcgtcgtcgccacactggggacaacaagctgctgcagcttcttca
atctgctggaggtcgggcccatctgcaatcaagagggggtctggctgca
tatcttcgccgcctatgccgggagcgccttcatctgccccgagttcaga
tatctgctgaatggggtcgagttcgccttcagcttcaatttcaatcccc
ataaatggctgctggtcaatttcttctgcagcgccatgtgggtcaaaag
aagaacattcctgacaggggccttcaatatgttccccgtctatctgaaa
catagccatcaattcagcgggttcatcacattctatagacattggcaaa
tccccctggggagaagattcagaagcctgaaaatgtggttcgtcttcag
aatgtatggggtcaaagggctgcaagcctatatcagaaaacatgtcgag
ctgagccatgagttcgagagcctggtcagacaattccccagattcgaga
tctgcacagaggtcatcctggggctggtctgcttcagactgaaagggag
caatgagctgaatgagacactgctgcaaagaatcaatagcgccaaaaaa
atccatctggtcccctgcagactgagattcaaattcgtcctgagattcg
ccgtctgcgccagaacagtcgagagcgcccatgtccaactggcctggga
gcatatcagcttcctggccagcagcgtcctgagagccgagaaagagtag
tagtcacactggctcaccttcgggtgggcctttctgcgtttata
=== Notes ===
I have not checked the above gene for palindromes. There are multiple ways of encoding most amino acids, I always used the same encoding for each amino acid. It might work, it might not work.
In theory, this is what I or you could do:
1) Buy the gene above on a plasmid from some online shop
2) Introduce the plasmid into a population of e coli (see youtube tutorials)
3) Kill off the e coli that did not assimilate the plasmid using a pencilin
4) Grow
5) Dry the biomass and harvest it using straight to base, or similiar
THIS IS PURELY THEORETICAL. I have no idea if it works. Please contribue with more ideas.

So there's difinitely risk involved if you're not careful: contamination could be disastrous. Plus, having done this technique for some experiments in college, it's something takes a little practice to get right. Also $50 doesn't seem bad, though I don't know how much one would need. Hopefully someone gives this a try though, it sounds like it could be the next big thing if someone can get it to work and condense it down to a kitchen friendly recipe. 